PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00173.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 268aa    MW: 31301.1 Da    PI: 9.5597
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00173.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.36.4e-121764148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEd++l+  +   G  +W+t++   g+ R +k+c++rw +yl
  Rsa1.0_00173.1_g00014.1 17 KGLWSPEEDQKLKSFILSQGHACWTTVPILAGLQRNGKSCRLRWINYL 64
                             678*******************************************97 PP

2Myb_DNA-binding52.51.1e-1670115148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg ++++E+e ++ ++  lG++ W++Ia++++ gRt++++k++w++yl
  Rsa1.0_00173.1_g00014.1  70 RGTFSAQEEETILTLHSSLGNK-WSRIAKYLP-GRTDNEIKNYWHSYL 115
                              899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6331264IPR017930Myb domain
SuperFamilySSF466891.76E-2614111IPR009057Homeodomain-like
SMARTSM007172.0E-71666IPR001005SANT/Myb domain
PfamPF002493.1E-101764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-191871IPR009057Homeodomain-like
CDDcd001677.62E-62064No hitNo description
PROSITE profilePS5129424.53865119IPR017930Myb domain
SMARTSM007179.7E-1669117IPR001005SANT/Myb domain
PfamPF002491.6E-1570115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2572118IPR009057Homeodomain-like
CDDcd001672.05E-1072115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGKMTKSGER PKQRQRKGLW SPEEDQKLKS FILSQGHACW TTVPILAGLQ RNGKSCRLRW  60
INYLRPGLKR GTFSAQEEET ILTLHSSLGN KWSRIAKYLP GRTDNEIKNY WHSYLKKRWL  120
KSQPQFKTER SNVTESSSSP LSCGKRNPET LDNVISFQKL PEKPPSAPSQ GRNKNMMNNN  180
NNMPKLFFSE WITSSDPHIN YSSDFTDSMH INRTQNRSED EELMMINNSY SSLEDDVMFR  240
TDFQQPHNEY ANYYTSEDFF INSDVTYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23171187107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196360.0AY519636.1 Arabidopsis thaliana MYB transcription factor (At5g52260) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013681885.10.0PREDICTED: transcription factor LAF1-like
RefseqXP_013683361.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K43e-97LAF1_ARATH; Transcription factor LAF1
TrEMBLM4EK120.0M4EK12_BRARP; Uncharacterized protein
STRINGBra029129.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-146myb domain protein 19